Structure of PDB 1ozb Chain C Binding Site BS01

Receptor Information
>1ozb Chain C (length=136) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEV
VLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNML
FPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMN
Ligand information
>1ozb Chain J (length=24) Species: 727 (Haemophilus influenzae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IGRNEPCPCGSGKKYKHCHGSRVA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ozb Structural determinants of SecB recognition by SecA in bacterial protein translocation
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D27 S29 E86
Binding residue
(residue number reindexed from 1)		D12 S14 E71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0015031 protein transport
GO:0051262 protein tetramerization
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ozb, PDBe:1ozb, PDBj:1ozb
PDBsum1ozb
PubMed14517549
UniProtP44853|SECB_HAEIN Protein-export protein SecB (Gene Name=secB)

[Back to BioLiP]