Structure of PDB 1osb Chain C Binding Site BS01

Receptor Information
>1osb Chain C (length=282) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYEGDASEWQGKGAEELGLSGEVDSKRFRELLA
GNIGEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEIIKAH
DRAVARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRERDPQL
HTHAVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQKLGYQ
LRYGKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLEQKQA
AKVLSRAKKTSVDREALRAEWQATAKELGIDF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1osb Recognition and processing of the origin of transfer DNA by conjugative relaxase TrwC.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		M1 S3 H4 S72 A73 R75 Q76 K79 R81 S89 A90 P91 K92 R128 Q129 K130 Q132 R154 Q159 H161 H163 R172 R178 A179 N182 D183 K187 N218 R226 S233 R235 T236 I239 L255 K258 K262 R266
Binding residue
(residue number reindexed from 1)		M1 S3 H4 S62 A63 R65 Q66 K69 R71 S79 A80 P81 K82 R118 Q119 K120 Q122 R144 Q149 H151 H153 R162 R168 A169 N172 D173 K177 N208 R216 S223 R225 T226 I229 L245 K248 K252 R256
Binding affinityPDBbind-CN: Kd=70nM
Enzymatic activity
Enzyme Commision number ?
External links