Structure of PDB 1nlp Chain C Binding Site BS01

Receptor Information
>1nlp Chain C (length=56) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nlp Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y14 T22 D23 D41 W42 Y55 P57 N59 Y60
Binding residue
(residue number reindexed from 1)		Y6 T14 D15 D33 W34 Y47 P49 N51 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Biological Process
GO:0006897 endocytosis
GO:0051666 actin cortical patch localization

View graph for
Biological Process
External links
PDB RCSB:1nlp, PDBe:1nlp, PDBj:1nlp
PDBsum1nlp
PubMed8807900
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]