Structure of PDB 1mxl Chain C Binding Site BS01

Receptor Information
>1mxl Chain C (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQ
NPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mxl Binding of cardiac troponin-I147-163 induces a structural opening in human cardiac troponin-C.
ResolutionN/A
Binding residue
(original residue number in PDB)		A22 A23 I26 V44 M47 L48 C84
Binding residue
(residue number reindexed from 1)		A22 A23 I26 V44 M47 L48 C84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:1mxl, PDBe:1mxl, PDBj:1mxl
PDBsum1mxl
PubMed10387074
UniProtP63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)

[Back to BioLiP]