Structure of PDB 1mse Chain C Binding Site BS01

Receptor Information
>1mse Chain C (length=105) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHL
NPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNST
MRRKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mse Solution structure of a specific DNA complex of the Myb DNA-binding domain with cooperative recognition helices.
ResolutionN/A
Binding residue
(original residue number in PDB)		K92 P94 W95 R125 K128 Q129 E132 R133 N136 H137 K144 T145 S146 W147 N183 S187 T188 R191
Binding residue
(residue number reindexed from 1)		K4 P6 W7 R37 K40 Q41 E44 R45 N48 H49 K56 T57 S58 W59 N95 S99 T100 R103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1mse, PDBe:1mse, PDBj:1mse
PDBsum1mse
PubMed7954830
UniProtP06876|MYB_MOUSE Transcriptional activator Myb (Gene Name=Myb)

[Back to BioLiP]