Structure of PDB 1mnm Chain C Binding Site BS01

Receptor Information
>1mnm Chain C (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGL
ENLMKNTSLSRIQIKNWVSNRRRKEKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mnm Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y131 R132 R135 F136 Q175 W179 N182 K186
Binding residue
(residue number reindexed from 1)		Y19 R20 R23 F24 Q63 W67 N70 K74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1mnm, PDBe:1mnm, PDBj:1mnm
PDBsum1mnm
PubMed9490409
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]