Structure of PDB 1mfq Chain C Binding Site BS01

Receptor Information
>1mfq Chain C (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFNEQESMARLKKLMTIMD
SMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQM
VKKMGGIK
Ligand information
>1mfq Chain A (length=128) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacacuaaguucggcaucaauauggugaccucccgggagcgggggaccac
cagguugccuaaggaggggugaaccggcccaggucggaaacggagcaggu
caaaacucccgugcugaucaguaguguc
<<<<<<<.<.<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>
>>.>>>>........<<<<<.....<<<<..<.<<<....>>>..>.>>>
>...>>>>>.>>>>>>>.>..>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mfq Induced structural changes of 7SL RNA during the assembly of human signal recognition particle
Resolution3.1 Å
Binding residue
(original residue number in PDB)		T377 D380 S381 M382 N383 G401 R402 R405 G409 S410 G411
Binding residue
(residue number reindexed from 1)		T47 D50 S51 M52 N53 G71 R72 R75 G79 S80 G81
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mfq, PDBe:1mfq, PDBj:1mfq
PDBsum1mfq
PubMed12244299
UniProtP61011|SRP54_HUMAN Signal recognition particle subunit SRP54 (Gene Name=SRP54)

[Back to BioLiP]