Structure of PDB 1m26 Chain C Binding Site BS01

Receptor Information
>1m26 Chain C (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>1m26 Chain B (length=15) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGISQTVIVGPWGAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m26 Crystal structure of the jacalin-T-antigen complex and a comparative study of lectin-T-antigen complexs
Resolution1.62 Å
Binding residue
(original residue number in PDB)
N105 P107 E109 N110 L131 L133
Binding residue
(residue number reindexed from 1)
N105 P107 E109 N110 L131 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1m26, PDBe:1m26, PDBj:1m26
PDBsum1m26
PubMed12206779
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]