Structure of PDB 1m1d Chain C Binding Site BS01

Receptor Information
>1m1d Chain C (length=162) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMV
ILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDH
MQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLM
ECYIHPYVDYGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m1d Structure of the GCN5 histone acetyltransferase bound to a bisubstrate inhibitor.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q376 L377 V423 L426 A427 V428 Q433 V434 G436 G438 T459 Y460 D462 F464 G467 Y468 F469 G495
Binding residue
(residue number reindexed from 1)		Q28 L29 V75 L78 A79 V80 Q85 V86 G88 G90 T111 Y112 D114 F116 G119 Y120 F121 G147
Enzymatic activity
Catalytic site (original residue number in PDB) Y415 F420 E422 V423 A424 L426 L458 I489 Y492
Catalytic site (residue number reindexed from 1) Y67 F72 E74 V75 A76 L78 L110 I141 Y144
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function
External links
PDB RCSB:1m1d, PDBe:1m1d, PDBj:1m1d
PDBsum1m1d
PubMed12391296
UniProtQ27198

[Back to BioLiP]