Structure of PDB 1lyb Chain C Binding Site BS01

Receptor Information
>1lyb Chain C (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLD
IACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQ
Ligand information
>1lyb Chain J (length=6) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VVVLAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lyb Crystal structures of native and inhibited forms of human cathepsin D: implications for lysosomal targeting and drug design.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
D33 G35 H77 Y78 G79 S80
Binding residue
(residue number reindexed from 1)
D33 G35 H77 Y78 G79 S80
Enzymatic activity
Enzyme Commision number 3.4.23.5: cathepsin D.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1lyb, PDBe:1lyb, PDBj:1lyb
PDBsum1lyb
PubMed8393577
UniProtP07339|CATD_HUMAN Cathepsin D (Gene Name=CTSD)

[Back to BioLiP]