Structure of PDB 1ltj Chain C Binding Site BS01

Receptor Information
>1ltj Chain C (length=299) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQI
HDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQ
KRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYA
LRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDF
GDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLN
GVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ltj 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		F295 T305 F322 Q329 D330 K338 C339 H340 Y363 D364 R375
Binding residue
(residue number reindexed from 1)		F200 T210 F227 Q234 D235 K243 C244 H245 Y268 D269 R280
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
Biological Process
GO:0007596 blood coagulation
GO:0030168 platelet activation
GO:0051258 protein polymerization
Cellular Component
GO:0005577 fibrinogen complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ltj, PDBe:1ltj, PDBj:1ltj
PDBsum1ltj
PubMed12356313
UniProtP02679|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]