Structure of PDB 1lqb Chain C Binding Site BS01

Receptor Information
>1lqb Chain C (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH
SYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKE
RCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lqb Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
N67 R69 I75 N78 W88 F91 Y98 P99 G104 T105 G106 R107 R108 H110 S111 Y112 H115 W117
Binding residue
(residue number reindexed from 1)
N7 R9 I15 N18 W28 F31 Y38 P39 G44 T45 G46 R47 R48 H50 S51 Y52 H55 W57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1lqb, PDBe:1lqb, PDBj:1lqb
PDBsum1lqb
PubMed12050673
UniProtP40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)

[Back to BioLiP]