Structure of PDB 1lf8 Chain C Binding Site BS01

Receptor Information
>1lf8 Chain C (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSP
QEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVS
EKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lf8 Phosphoregulation of sorting signal-VHS domain interactions by a direct electrostatic mechanism.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K86 F87 R88 N91 S98 K100 Y101 K130 M137 Q141 I143
Binding residue
(residue number reindexed from 1)		K79 F80 R81 N84 S91 K93 Y94 K123 M130 Q134 I136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
GO:0035091 phosphatidylinositol binding
GO:0043130 ubiquitin binding
Biological Process
GO:0006886 intracellular protein transport
Cellular Component
GO:0005802 trans-Golgi network

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1lf8, PDBe:1lf8, PDBj:1lf8
PDBsum1lf8
PubMed12032548
UniProtQ9NZ52|GGA3_HUMAN ADP-ribosylation factor-binding protein GGA3 (Gene Name=GGA3)

[Back to BioLiP]