Structure of PDB 1l6o Chain C Binding Site BS01

Receptor Information
>1l6o Chain C (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l6o Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F264 L265 G266 I267 S268 I269 V270 G271 V321
Binding residue
(residue number reindexed from 1)		F14 L15 G16 I17 S18 I19 V20 G21 V71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016055 Wnt signaling pathway

View graph for
Biological Process
External links
PDB RCSB:1l6o, PDBe:1l6o, PDBj:1l6o
PDBsum1l6o
PubMed11970895
UniProtP51142|DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 (Gene Name=dvl2)

[Back to BioLiP]