Structure of PDB 1ko6 Chain C Binding Site BS01

Receptor Information

>1ko6 Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HPAGIILTKVGYYTIPSMDDLAKITNECIVSDFTIGRKGYGSIYFEGDVN
LTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKT
SRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF

Ligand information

>1ko6 Chain D (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KYGLQD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ko6 The three-dimensional structure of the autoproteolytic, nuclear pore-targeting domain of the human nucleoporin Nup98.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	K780 E781 V782 V783 Q842 W856 V860 H862 F863
Binding residue (residue number reindexed from 1)	K65 E66 V67 V68 Q127 W141 V145 H147 F148

Enzymatic activity

Enzyme Commision number

3.4.21.-

Gene Ontology

	Molecular Function
GO:0017056	structural constituent of nuclear pore

	Biological Process
GO:0006913	nucleocytoplasmic transport

	Cellular Component
GO:0005643	nuclear pore

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ko6, PDBe:1ko6, PDBj:1ko6
PDBsum	1ko6
PubMed	12191480
UniProt	P52948\|NUP98_HUMAN Nuclear pore complex protein Nup98-Nup96 (Gene Name=NUP98)

[Back to BioLiP]