Structure of PDB 1kl3 Chain C Binding Site BS01

Receptor Information
>1kl3 Chain C (length=120) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kl3 Improved affinity of engineered streptavidin for the Strep-tag II peptide is due to a fixed open conformation of the lid-like loop at the binding site.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T45 W79 R84 S88 T90 W92 W108
Binding residue
(residue number reindexed from 1)		T31 W65 R70 S74 T76 W78 W94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1kl3, PDBe:1kl3, PDBj:1kl3
PDBsum1kl3
PubMed11910031
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]