Structure of PDB 1k6o Chain C Binding Site BS01

Receptor Information
>1k6o Chain C (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLV
ASETGHVYTFATRKLQPMITSETGKALIQTCLNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k6o Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex.
Resolution3.19 Å
Binding residue
(original residue number in PDB)
G142 R143 V144 T160 R164
Binding residue
(residue number reindexed from 1)
G5 R6 V7 T23 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1k6o, PDBe:1k6o, PDBj:1k6o
PDBsum1k6o
PubMed11846562
UniProtP11831|SRF_HUMAN Serum response factor (Gene Name=SRF)

[Back to BioLiP]