Structure of PDB 1jyc Chain C Binding Site BS01

Receptor Information
>1jyc Chain C (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN
Ligand information
>1jyc Chain R (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVWYPYGSYLTASGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jyc Plasticity in Protein-Peptide Recognition: Crystal Structures of Two Different Peptides Bound to Concanavalin A
Resolution2.75 Å
Binding residue
(original residue number in PDB)
K39 W40 N41 N44 G45 K46 S201 P202 S204 H205 P206
Binding residue
(residue number reindexed from 1)
K39 W40 N41 N44 G45 K46 S201 P202 S204 H205 P206
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005537 D-mannose binding
GO:0030246 carbohydrate binding
GO:0046872 metal ion binding
GO:0090729 toxin activity
Biological Process
GO:0035821 modulation of process of another organism

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1jyc, PDBe:1jyc, PDBj:1jyc
PDBsum1jyc
PubMed11371463
UniProtP55915|CONA_CANBR Concanavalin-Br

[Back to BioLiP]