Structure of PDB 1jui Chain C Binding Site BS01

Receptor Information
>1jui Chain C (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jui Plasticity in protein-peptide recognition: crystal structures of two different peptides bound to concanavalin A.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		N41 Q43 N44 K46 A70 D71 S201 P202
Binding residue
(residue number reindexed from 1)		N41 Q43 N44 K46 A70 D71 S201 P202
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005537 D-mannose binding
GO:0030246 carbohydrate binding
GO:0046872 metal ion binding
GO:0090729 toxin activity
Biological Process
GO:0035821 modulation of process of another organism

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jui, PDBe:1jui, PDBj:1jui
PDBsum1jui
PubMed11371463
UniProtP55915|CONA_CANBR Concanavalin-Br

[Back to BioLiP]