Structure of PDB 1joj Chain C Binding Site BS01

Receptor Information

>1joj Chain C (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN

Ligand information

>1joj Chain R (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MYWYPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1joj Enhanced binding of a rationally designed peptide ligand of concanavalin a arises from improved geometrical complementarity.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	M42 Q43 N44 K46 K200 S204
Binding residue (residue number reindexed from 1)	M42 Q43 N44 K46 K200 S204

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005537	D-mannose binding
GO:0030246	carbohydrate binding
GO:0046872	metal ion binding
GO:0090729	toxin activity

	Biological Process
GO:0035821	modulation of process of another organism

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1joj, PDBe:1joj, PDBj:1joj
PDBsum	1joj
PubMed	11580281
UniProt	P55915\|CONA_CANBR Concanavalin-Br

[Back to BioLiP]