Structure of PDB 1jko Chain C Binding Site BS01

Receptor Information

>1jko Chain C (length=46) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS

Ligand information

>1jko Chain A (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgtttttggtaaga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1jko Testing water-mediated DNA recognition by the Hin recombinase.
Resolution	2.24 Å
Binding residue (original residue number in PDB)	G139 R140 R142 S174 T175 R178 Y179
Binding residue (residue number reindexed from 1)	G1 R2 R4 S36 T37 R40 Y41
Binding affinity	PDBbind-CN: Kd=7.6nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1jko, PDBe:1jko, PDBj:1jko
PDBsum	1jko
PubMed	11847127
UniProt	P03013\|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]