Structure of PDB 1imh Chain C Binding Site BS01

Receptor Information
>1imh Chain C (length=281) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGF
PTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIE
GTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARL
VFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEV
FLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHD
QHITLPVSVGIYVVTNAGRSHDVQPFTYTPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1imh Structure of a TonEBP-DNA complex reveals DNA encircled by a transcription factor.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R217 G224 S225 R226 G227 Q364 K392
Binding residue
(residue number reindexed from 1)		R30 G37 S38 R39 G40 Q177 K205
Binding affinityPDBbind-CN: Kd=30nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1imh, PDBe:1imh, PDBj:1imh
PDBsum1imh
PubMed11780147
UniProtO94916|NFAT5_HUMAN Nuclear factor of activated T-cells 5 (Gene Name=NFAT5)

[Back to BioLiP]