Structure of PDB 1gt0 Chain C Binding Site BS01

Receptor Information
>1gt0 Chain C (length=137) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEA
LNLSFKNMSKLKPLLEKWLNDAENLGLSRRRKKRTSIETNIRVALEKSFL
ENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gt0 Crystal Structure of a POU/Hmg/DNA Ternary Complex Suggests Differential Assembly of Oct4 and Sox2 on Two Enhancers
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R20 T26 Q27 Q44 T45 S48 R49 R102 K103 R105 T106 R113 V147 N151 K155
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 Q42 T43 S46 R47 R81 K82 R84 T85 R92 V126 N130 K134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gt0, PDBe:1gt0, PDBj:1gt0
PDBsum1gt0
PubMed12923055
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]