Structure of PDB 1g2f Chain C Binding Site BS01

Receptor Information
>1g2f Chain C (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASL
NAHIRTHTGEKPFACDICGRKFATLHTRTRHTKIHLRQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g2f Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R114 Q118 N121 H125 R142 Q146 S149 H153 T156 R170 T177 R180 H181 R187 K189
Binding residue
(residue number reindexed from 1)		R14 Q18 N21 H25 R42 Q46 S49 H53 T56 R70 T77 R80 H81 R87 K89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g2f, PDBe:1g2f, PDBj:1g2f
PDBsum1g2f
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]