Structure of PDB 1g2d Chain C Binding Site BS01

Receptor Information
>1g2d Chain C (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQHTGL
NQHIRTHTGEKPFACDICGRKFATLHTRDRHTKIHLRQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1g2d Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R114 Q118 N121 H125 I128 R142 Q146 Q152 H153 T156 R170 T177 R180 H181 I184 K189
Binding residue
(residue number reindexed from 1)		R14 Q18 N21 H25 I28 R42 Q46 Q52 H53 T56 R70 T77 R80 H81 I84 K89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1g2d, PDBe:1g2d, PDBj:1g2d
PDBsum1g2d
PubMed11587646
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]