Structure of PDB 1eyg Chain C Binding Site BS01

Receptor Information
>1eyg Chain C (length=112) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKE
QTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTE
VVVNVGGTMQML
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		A3001 S3002 N3013 Q3016 T3033 A3035 E3038 S3039 W3040 Q3051 T3052 W3054 H3055 R3056 V3058 F3060 K3073 G3074 Q3076 Q3082 R3084 T3085 R3086 W3088 Y3097 T3098 E3100 V3102 N3104 V3105 G3106
Binding residue
(residue number reindexed from 1)		A1 S2 N13 Q16 T33 A35 E38 S39 W40 Q51 T52 W54 H55 R56 V58 F60 K73 G74 Q76 Q82 R84 T85 R86 W88 Y97 T98 E100 V102 N104 V105 G106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
PDBsum1eyg
PubMed10932248
UniProtP0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]