Structure of PDB 1evw Chain C Binding Site BS01

Receptor Information
>1evw Chain C (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESADDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1evw Conformational changes and cleavage by the homing endonuclease I-PpoI: a critical role for a leucine residue in the active site.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		A48 P49 G51 V52 G53 K56 N57 K65 R66
Binding residue
(residue number reindexed from 1)		A47 P48 G50 V51 G52 K55 N56 K64 R65
Binding affinityPDBbind-CN: Kd=10pM
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1evw, PDBe:1evw, PDBj:1evw
PDBsum1evw
PubMed10891275
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]