Structure of PDB 1ejh Chain C Binding Site BS01

Receptor Information

>1ejh Chain C (length=181) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQ
LSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFW
LETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKNRFVV

Ligand information

>1ejh Chain G (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KQYDREFLLDFQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ejh Cap-dependent translation initiation in eukaryotes is regulated by a molecular mimic of eIF4G.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	H37 P38 L39 Q40 W73 N77 E132 L135 G139 E140 R186
Binding residue (residue number reindexed from 1)	H7 P8 L9 Q10 W43 N47 E102 L105 G109 E110 R156

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003743	translation initiation factor activity

	Biological Process
GO:0006413	translational initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ejh, PDBe:1ejh, PDBj:1ejh
PDBsum	1ejh
PubMed	10394359
UniProt	P63073\|IF4E_MOUSE Eukaryotic translation initiation factor 4E (Gene Name=Eif4e)

[Back to BioLiP]