Structure of PDB 1ddl Chain C Binding Site BS01

Receptor Information

>1ddl Chain C (length=175) Species: 70821 (Desmodium yellow mottle virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NTKPSLLPPPVGNPPPVISYPFQITLASLGTEDAADSVSIASNSVLATYT
ALYRHAQLKHLKATIHPTYMAPKYPTSVALVWVPANSTATSTQVLDTYGG
LHFCIGGSVNSVKPIDVEANLTNLNPIIKASTTFTDTPKLLYYSKAQATA
PTSPTCYLTIQGQIELSSPLLQASS

Ligand information

>1ddl Chain D (length=7) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuuuu

.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ddl Refined structure of desmodium yellow mottle tymovirus at 2.7 A resolution.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	L114 H115
Binding residue (residue number reindexed from 1)	L101 H102

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid
GO:0044423	virion component

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1ddl, PDBe:1ddl, PDBj:1ddl
PDBsum	1ddl
PubMed	10966774
UniProt	O89511

[Back to BioLiP]