Structure of PDB 1cmx Chain C Binding Site BS01

Receptor Information
>1cmx Chain C (length=210) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVVPIESNPEVFTNFAHKLGLKNEWAYFDIYSLTEPELLAFLPRPVKAIV
LLFPVIWFKQSVKNACGLYAILHSLSNNQSLLEPGSDLDNFLKSQSDTSS
SKNRFDDVTTDQFVLNVIKENVQTFSTGQSEAPEATADTNLHYITYVEEN
GGIFELDGRNLSGPLYLGKSDPTATDLIEQELVRVRVASYMENANEEDVL
NFAMLGLGPN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cmx Structural basis for the specificity of ubiquitin C-terminal hydrolases.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		P410 I411 E412 S413 N414 P415 D435 Y437 L458 N488 C490 Q553 S554 P557 T563 L565 Y567 M615 N619 L624 N625 F626
Binding residue
(residue number reindexed from 1)		P4 I5 E6 S7 N8 P9 D29 Y31 L52 N64 C66 Q129 S130 P133 T139 L141 Y143 M191 N195 L200 N201 F202
Enzymatic activity
Catalytic site (original residue number in PDB) Q484 C490 H566 D581
Catalytic site (residue number reindexed from 1) Q60 C66 H142 D157
Enzyme Commision number 3.4.19.12: ubiquitinyl hydrolase 1.
Gene Ontology
Molecular Function
GO:0004843 cysteine-type deubiquitinase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0010992 ubiquitin recycling
GO:0016579 protein deubiquitination
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cmx, PDBe:1cmx, PDBj:1cmx
PDBsum1cmx
PubMed10406793
UniProtP35127|UBL1_YEAST Ubiquitin carboxyl-terminal hydrolase YUH1 (Gene Name=YUH1)

[Back to BioLiP]