Structure of PDB 1c0w Chain C Binding Site BS01

Receptor Information
>1c0w Chain C (length=175) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERD
GLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEA
CRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVIVQINEIFQVE
TDQFTQLLDADIRVELLDDLAHTIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c0w Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
T7 Q36 S37 P39 T40 Q43 R47 R50
Binding residue
(residue number reindexed from 1)
T6 Q35 S36 P38 T39 Q42 R46 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0017124 SH3 domain binding
GO:0042802 identical protein binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1c0w, PDBe:1c0w, PDBj:1c0w
PDBsum1c0w
PubMed10497029
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]