Structure of PDB 1bbx Chain C Binding Site BS01

Receptor Information
>1bbx Chain C (length=63) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDA
PKELLQMLEKQKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bbx Architecture of Nonspecific Protein-DNA Interactions in the Sso7D-DNA Complex
ResolutionN/A
Binding residue
(original residue number in PDB)		V25 G26 K27 M28 R42
Binding residue
(residue number reindexed from 1)		V25 G26 K27 M28 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1bbx, PDBe:1bbx, PDBj:1bbx
PDBsum1bbx
PubMed9665172
UniProtP39476|DN7D_SACS2 DNA-binding protein 7d (Gene Name=sso7d)

[Back to BioLiP]