Structure of PDB 8apn Chain Bu Binding Site BS01

Receptor Information
>8apn Chain Bu (length=167) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFSRYFVQKFKQSYTRKYMRDMESGAFSFPKCHDILGKYRPDVLFAAAAA
PLKLELPEQAVYKKLYRDFPELRKDAVDLSSLEAPLAKQFALKHLVLSAE
IAANSPRTRHILRRDLEADPAYERLKEEFMPRIAELRKQQEQTASLQQLQ
ADEEEHLKLALTYVAAQ
Ligand information
>8apn Chain Ui (length=26) Species: 353565 (Polytomella magna) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E167 H170 Y177
Binding residue
(residue number reindexed from 1)		E153 H156 Y163
External links