Structure of PDB 8ove Chain Bt Binding Site BS01

Receptor Information
>8ove Chain Bt (length=97) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNYPKKKKMHCPDERCNAHKSFKVVQYKAGKARLYARGKRRYDRKQSGYG
GQTKPIFHKKAKTTKKIVLKLQCSNCKSIIQNVLKRTKHFELNDKKK
Ligand information
>8ove Chain AB (length=19) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggaguccgggcacca
<<<<<<...>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y43 P56 I57
Binding residue
(residue number reindexed from 1)		Y42 P55 I56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtP17843|RL44_TRYBB Large ribosomal subunit protein eL42 (Gene Name=RPL44)

[Back to BioLiP]