Structure of PDB 9f1c Chain Bl Binding Site BS01

Receptor Information
>9f1c Chain Bl (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>9f1c Chain B8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<....>><<<<<<<<<.....>>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9f1c NAC guides a ribosomal multienzyme complex for nascent protein processing.
Resolution3.78 Å
Binding residue
(original residue number in PDB)		T6 F7 R8 K15 K18 Q19 R21 I23 P24 W26 I27 M29 K30 T31 I35 K40
Binding residue
(residue number reindexed from 1)		T5 F6 R7 K14 K17 Q18 R20 I22 P23 W25 I26 M28 K29 T30 I34 K39
External links