Structure of PDB 8ove Chain Bg Binding Site BS01

Receptor Information
>8ove Chain Bg (length=92) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTINTKIQLVMKSGKYVLGTQQSLKTLRQGRSKLVVISANCPPIRKAEIE
YYCTLSKTPIHHYSGNNLDLGTACGRHFRACVLSITDVGDSD
Ligand information
>8ove Chain BE (length=166) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaugcgcuugccaggugacccauccauccucccacggugagcuuu
cuuuucaccauaauccaccuugggccucucgacgcguuacucggagcggg
ggcucaagauugaaaaaugcagcacugucugugaguucggcgcauuaaag
caaaaaccuggggugu
<<<....>>>..<..<<<<<<.......<<...<<<.<<.<<<<<<....
...>>>>>><...<<.<.<<<<<<<<<<<...<<.......>>....>>>
>>>>>>>>.>.>>....><<<<..>>>>.>>.>>>...>>..........
.....>>>>>>.>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
G37 T38 Q39 Q40 R63 F96 R97 C99
Binding residue
(residue number reindexed from 1)
G19 T20 Q21 Q22 R45 F78 R79 C81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtP49153|RL30_TRYBB Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]