Structure of PDB 8ope Chain Be Binding Site BS01

Receptor Information
>8ope Chain Be (length=186) Species: 122280 (Potato virus Y strain NTN) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HTVPRIKAITSKMRMPKSKGATVLNLEHLLEYAPQQIDISNTRATQSQFD
TWYEAVQLAYDIGETEMPTVMNGLMVWCIENGTSPNINGVWVMMDGDEQV
EYPLKPIVENAKPTLRQIMAHFSDVAEAYIEMRNKKEPYMPRYGLVRNLR
DGSLARYAFDFYEVTSRTPVRAREAHIQMKAAALKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ope From structural polymorphism to structural metamorphosis of the coat protein of flexuous filamentous potato virus Y
Resolution3.09 Å
Binding residue
(original residue number in PDB)
N82 G123 S125 P126 N127 I128 T155 R157 Q158 R183 Y184 R188 D201 K221 A224 L225
Binding residue
(residue number reindexed from 1)
N41 G82 S84 P85 N86 I87 T114 R116 Q117 R142 Y143 R147 D160 K180 A183 L184
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:8ope, PDBe:8ope, PDBj:8ope
PDBsum8ope
PubMed38233506
UniProtA0A0A7DJG2

[Back to BioLiP]