Structure of PDB 8apo Chain Be Binding Site BS01

Receptor Information
>8apo Chain Be (length=228) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
INMDQYLRMDNQDTLELLVQAKDNFLKKDERTIPIPQSVREVMYRHRWDK
VIVDVRRLVYRTKNNKREQYTAMVASGNQKGLLGLGMGSAETAQLAVARA
YLDSFSNLAAVPLYRGHTVYHHVEHHFQRVKVTLSPRTSGWGLRCSNLFY
ELCSLAGIRDLTVDVSGATRNKFFVAKAFFDALQKQTAPHDGVEGTGVYV
KEVVRRPVVNLGTYRNNGTLPPKEYLAT
Ligand information
>8apo Chain B1 (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cauaggguuugguuuuugcccagccuuuagcuuagcguuaagcuuauaca
ugcuagccuaaaagacggcgcacaggugcauauuuuguaagcauguaaaa
ua
....<<<<.........>>>>.............................
.....<<<........>>>...............................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R19 L21 R92 R100 W104 R107 C108 N134 P170 V172 T182
Binding residue
(residue number reindexed from 1)		R56 L58 R129 R137 W141 R144 C145 N171 P207 V209 T219
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 22:25:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8apo', asym_id = 'Be', bs = 'BS01', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8apo', asym_id='Be', bs='BS01', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '8apo', asym_id = 'Be'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='8apo', asym_id='Be')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>