Structure of PDB 8oiq Chain Bd Binding Site BS01

Receptor Information
>8oiq Chain Bd (length=69) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDS
LSPEERRARFRKREAKFKE
Ligand information
>8oiq Chain B9 (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaauuaucaaagcaaggcacugaaaaugccuagauga
gccucacagcuccauaaacacca
<<<.<<<..<<<...........>>>.<<<<<.......>>>>>....<<
<<......>>>>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oiq Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R43 Q47
Binding residue
(residue number reindexed from 1)		R9 Q13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005762 mitochondrial large ribosomal subunit

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8oiq, PDBe:8oiq, PDBj:8oiq
PDBsum8oiq
PubMed37141370
UniProtA0A4X1ULI6

[Back to BioLiP]