Structure of PDB 6gaw Chain Bd Binding Site BS01

Receptor Information
>6gaw Chain Bd (length=99) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPIEDFITPVKFLNKERQRPPVELPFEESERRALLLKRWSLYKQREHEME
RSAIRSLLEAQEEALQELRLSSPELHAEATKRDPSLFPFERQGPDYTPP
Ligand information
>6gaw Chain BB (length=67) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaucaaagcaaggcacugaaaaugccuagaugagccu
cagcuccauaaacacca
<<<.<<<..<<<.......>>>.<<<<<.......>>>>>....<<<<..
..>>>>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gaw Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		F88 K119 S122 Q126 R133
Binding residue
(residue number reindexed from 1)		F6 K37 S40 Q44 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Cellular Component
External links
PDB RCSB:6gaw, PDBe:6gaw, PDBj:6gaw
PDBsum6gaw
PubMed30089917
UniProtA0A286ZP98

[Back to BioLiP]