Structure of PDB 4v98 Chain Bd Binding Site BS01

Receptor Information
>4v98 Chain Bd (length=216) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFK
CLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKW
KEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLAR
WLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLL
TLTVQVFAQNDFKDYI
Ligand information
>4v98 Chain Bc (length=17) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVWDDSLLVKTYDESVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v98 Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
Q8061 L8075 P8108 L8109 L8110 S8111 A8148 R8149 Y8152 A8153 V8156 Q8190 L8197
Binding residue
(residue number reindexed from 1)
Q62 L76 P109 L110 L111 S112 A149 R150 Y153 A154 V157 Q191 L198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0006397 mRNA processing
GO:0007629 flight behavior
GO:0008344 adult locomotory behavior
GO:0008380 RNA splicing
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0032797 SMN complex
GO:0034718 SMN-Gemin2 complex
GO:0034730 SmD-containing SMN-Sm protein complex
GO:0071254 cytoplasmic U snRNP body

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v98, PDBe:4v98, PDBj:4v98
PDBsum4v98
PubMed23333303
UniProtQ9VVX0|GEMI2_DROME Protein Gemin2 (Gene Name=Gem2)

[Back to BioLiP]