Structure of PDB 7uio Chain Bc Binding Site BS01

Receptor Information
>7uio Chain Bc (length=107) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDSIIPAGVKLDDLQVILAKNENETRDKVCKQINEARDEILPLRLQFNEF
IQIMANIDQEGSKQADRMAKYLHIRDKILQLNDRFQTLSSHLEALQPLFS
TVPEYLK
Ligand information
Ligand IDTHR
InChIInChI=1S/C4H9NO3/c1-2(6)3(5)4(7)8/h2-3,6H,5H2,1H3,(H,7,8)/t2-,3+/m1/s1
InChIKeyAYFVYJQAPQTCCC-GBXIJSLDSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04O=C(O)C(N)C(O)C
OpenEye OEToolkits 1.5.0CC(C(C(=O)O)N)O
CACTVS 3.341C[CH](O)[CH](N)C(O)=O
CACTVS 3.341C[C@@H](O)[C@H](N)C(O)=O
OpenEye OEToolkits 1.5.0C[C@H]([C@@H](C(=O)O)N)O
FormulaC4 H9 N O3
NameTHREONINE
ChEMBLCHEMBL291747
DrugBankDB00156
ZINCZINC000000895103
PDB chain7uio Chain Bc Residue 108 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uio Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E104 L106 K107
Binding residue
(residue number reindexed from 1)		E104 L106 K107
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0034605 cellular response to heat
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uio, PDBe:7uio, PDBj:7uio
PDBsum7uio
PubMed36731470
UniProtP40356|MED3_YEAST Mediator of RNA polymerase II transcription subunit 3 (Gene Name=PGD1)

[Back to BioLiP]