Structure of PDB 8apo Chain Bb Binding Site BS01

Receptor Information

>8apo Chain Bb (length=236) Species: 353565 (Polytomella magna)

GASLNISELMKVLLQPLPLGKVRNSSLNDVVVEVENFWYINPEKTLASLA
RSLYIIKDVLEQDGHILIVNSNPKLKPLVRESAYCCLNSNVWFYHDEWIP
GLLTKPELYPTLFNKQRPLLDILDKHRLLAKVRGPKGRESLDILKSVLNA
EAESARLPVPNSATGALSKLALVICLDPTYNAEVLREAYFKSLLTISLVN
SHSDLSSVTYPVYASDTHIGFQHFFLEWILRVSNLD

Ligand information

>8apo Chain Um (length=11) Species: 353565 (Polytomella magna)

AAAAAAAAAAA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8apo Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): Y86 W94
• Binding residue (residue number reindexed from 1): Y84 W92

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 22:26:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8apo', asym_id = 'Bb', bs = 'BS01', title = 'Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8apo', asym_id='Bb', bs='BS01', title='Structure of the mitochondrial ribosome from Polytomella magna with tRNAs bound to the A and P sites')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '8apo', asym_id = 'Bb'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='8apo', asym_id='Bb')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>