Structure of PDB 8evt Chain BZ Binding Site BS01

Receptor Information
>8evt Chain BZ (length=69) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKE
GIIKPISKHSKQAIYTRAT
Ligand information
>8evt Chain EC (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguuugcuauuuagcguacguguaccauaggcagccccaaaaacacguaa
ugccugc
<<<..<<<....>>>.....((.>>>...<<.....>>.....)).....
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8evt Regulation of translation by ribosomal RNA pseudouridylation.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R49 E53 Y57 R58 Y59 R68 K70
Binding residue
(residue number reindexed from 1)		R13 E17 Y21 R22 Y23 R32 K34
Enzymatic activity
Enzyme Commision number ?
External links