Structure of PDB 4v4r Chain BZ Binding Site BS01

Receptor Information
>4v4r Chain BZ (length=177) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MELTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTG
LFDITVEGGETFPALVKAVQMDKRKRAPIHVDFYMVTYGEPVEVSVPVHT
TGRSQGEVQGGLVDIVVHNLQIVAPGPRRIPQELVVDVTKMNIGDHITAG
DIKLPEGCTLAADPELTVVSVLPPRLT
Ligand information
>4v4r Chain BB (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau
..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
Resolution5.9 Å
Binding residue
(original residue number in PDB)		P10 L14 V22 Y24 N29 F32 K67 K73 H80 V81 E93
Binding residue
(residue number reindexed from 1)		P10 L14 V22 Y24 N29 F32 K67 K73 H80 V81 E93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
PDBsum4v4r
PubMed16377566
UniProtQ9RX88|RL25_DEIRA Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]