Structure of PDB 4v7h Chain BX Binding Site BS01

Receptor Information
>4v7h Chain BX (length=86) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQAAAAAAAAAAAAAAAAAAAAAAAAA
Ligand information
>4v7h Chain B4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauguagguugcagaauuccgugaaucaucgaucuu
ugaacgcacauugcgccccuugguauuccagggggcaugccuguuugagc
gucauuu
.........................................<<<<<<...
.....>>>.......<<<......................>>>.....>>
>...............<<<<<<<....>>>>>>>................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
Resolution8.9 Å
Binding residue
(original residue number in PDB)		A2 G3 V4 K5 A6 Y7 R10 K25 K32 K35 R38 P39 S40 L41 I44 K45 T46 V47 R48 K49 S50 I51 A52 C53 T56 A89
Binding residue
(residue number reindexed from 1)		A1 G2 V3 K4 A5 Y6 R9 K24 K31 K34 R37 P38 S39 L40 I43 K44 T45 V46 R47 K48 S49 I50 A51 C52 T55 A79
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 23 04:56:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v7h', asym_id = 'BX', bs = 'BS01', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v7h', asym_id='BX', bs='BS01', title='Comprehensive molecular structure of the eukaryotic ribosome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '4v7h', asym_id = 'BX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='4v7h', asym_id='BX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>