Structure of PDB 7nqh Chain BS Binding Site BS01

Receptor Information
>7nqh Chain BS (length=143) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQ
HHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCL
EAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Ligand information
>7nqh Chain BB (length=67) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaucaaagcaaggcacugaaaaugccuagaugagccu
cagcuccauaaacacca
<<<.<<<..<<<.......>>>.<<<<<.......>>>>>....<<<<..
..>>>>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nqh Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
R85 T86 Q87 H88 H89 R108 W110 K113 N121 V122 W151 S157
Binding residue
(residue number reindexed from 1)
R48 T49 Q50 H51 H52 R71 W73 K76 N84 V85 W114 S120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nqh, PDBe:7nqh, PDBj:7nqh
PDBsum7nqh
PubMed33878294
UniProtA0A286ZNK1

[Back to BioLiP]