Structure of PDB 4v4t Chain BS Binding Site BS01

Receptor Information
>4v4t Chain BS (length=113) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTPNGDDTLAS
AHSSDLAEYGWEPTGSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPKVF
AIQEGAIDAGLDI
Ligand information
>4v4t Chain BB (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau
..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4t Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
Resolution6.46 Å
Binding residue
(original residue number in PDB)
M10 R11 R23 R37 S39 K41 H42 R44 Q46 D56 A59 S64 D65 E72 P74 T75 N107 S108 T110 P111
Binding residue
(residue number reindexed from 1)
M2 R3 R15 R29 S31 K33 H34 R36 Q38 D46 A49 S54 D55 E62 P63 T64 N93 S94 T96 P97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4t, PDBe:4v4t, PDBj:4v4t
PDBsum4v4t
PubMed16377566
UniProtP14123|RL18_HALMA Large ribosomal subunit protein uL18 (Gene Name=rpl18)

[Back to BioLiP]