Structure of PDB 4v4r Chain BS Binding Site BS01

Receptor Information

>4v4r Chain BS (length=113) Species: 274 (Thermus thermophilus)

PMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTPNGDDTLAS
AHSSDLAEYGWEPTGSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPKVF
AIQEGAIDAGLDI

Ligand information

>4v4r Chain BB (length=123)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Resolution: 5.9 Å
• Binding residue (original residue number in PDB): M10 R11 R23 R37 S39 K41 H42 R44 Q46 D56 A59 H62 S64 D65 E72 P74 T75 N107 S108 T110 P111
• Binding residue (residue number reindexed from 1): M2 R3 R15 R29 S31 K33 H34 R36 Q38 D46 A49 H52 S54 D55 E62 P63 T64 N93 S94 T96 P97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
• PDBsum: 4v4r
• PubMed: 16377566
• UniProt: P14123|RL18_HALMA Large ribosomal subunit protein uL18 (Gene Name=rpl18)