Structure of PDB 4v6u Chain BN Binding Site BS01

Receptor Information
>4v6u Chain BN (length=168) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRPAKIDRYVDKPAYTRREYIRGAPGPKITIFDMGNPAGDFEFEVSLHTA
EPVQIRQNALEAARQQVNRYLQKNVGRSNYHFKIRVYPFQVLRENPMATG
RKADRYGNGMRRPFGKPIGLAARLKKDQKILSIRVNRQHLKFAIEGARRA
AMKFPCKCYYRIYDKEGN
Ligand information
>4v6u Chain A0 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgccguagcuuagcugguggagcgccggacuguuaauccggcgguccc
cgguucgaauccgggcggcggcgcca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
Resolution6.6 Å
Binding residue
(original residue number in PDB)
R24 K104 A105 D106 Y108
Binding residue
(residue number reindexed from 1)
R22 K102 A103 D104 Y106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ9UWP5|RL10E_PYRFU Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]